PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g008090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 528aa    MW: 58818.6 Da    PI: 6.0897
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g008090.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-173582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++l+d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
   Csa13g008090.1 35 KGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 82
                     79******************************************9986 PP

2Myb_DNA-binding51.81.9e-1688131146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E++l+v++++++G++ W++ a++++ gRt++++k++w++
   Csa13g008090.1  88 KGAFSQDEEQLIVELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 131
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016931.6E-2601527IPR016310Transcription factor, GAMYB
PROSITE profilePS5129416.0383082IPR017930Myb domain
SuperFamilySSF466891.45E-2932129IPR009057Homeodomain-like
SMARTSM007176.5E-153484IPR001005SANT/Myb domain
PfamPF002491.5E-153582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-233689IPR009057Homeodomain-like
CDDcd001671.35E-113782No hitNo description
PROSITE profilePS5129425.72583137IPR017930Myb domain
SMARTSM007171.1E-1687135IPR001005SANT/Myb domain
PfamPF002493.4E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2590136IPR009057Homeodomain-like
CDDcd001674.78E-1290131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MSNTSTDSDH NESPATDDNN GSDCRSRWER SGLKKGPWSS AEDDILIDYV NKHGEGNWNA  60
VQKHTGLFRC GKSCRLRWAN HLRPNLKKGA FSQDEEQLIV ELHAKMGNRW ARMAAHLPGR  120
TDNEIKNYWN TRIKRRQRAG LPLYPPEMHL EVLDWSQEYA KNRFMGEDRR HSDFLQLGSC  180
ESDVFFDNLG FVTTDMVPGA SDLSDMTAYK NMANAASSPR YDNFMAPMMP CSRRFWESEL  240
LYPGCSSTIK QEFPSPEQFV NTSSPQKISK TCSFSVPCDV YHPLLYGNQQ HSPVVIPDSH  300
TPTGGIVPSS KPSSYGAVKL ELPSFQYSET TFDQWKKSSS PPHSDLLDPF DSYIHSPPPP  360
TGRQESDCFS NCDTGLLDML LLEAKIRNST TKNNLYKSCA STIPSADLGE VTVSQTKSEE  420
FDNSLKSFVH SEISTQQNAD GIPPRQREKK RKSLLDITRP DVLLASSWLD HGLGIAKESG  480
SMSDALTVLL GDDIGNEYMH TSVGASSGVG SCSWSNMPPV CQMTELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-312413613127MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1443451PRQREKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4119690.0AF411969.1 Arabidopsis thaliana putative transcription factor MYB33 (MYB33) mRNA, complete cds.
GenBankAK1189370.0AK118937.1 Arabidopsis thaliana At5g06100 mRNA for putative transcription factor MYB33, complete cds, clone: RAFL21-27-I01.
GenBankAY5196160.0AY519616.1 Arabidopsis thaliana MYB transcription factor (At5g06100) mRNA, complete cds.
GenBankBT0060490.0BT006049.1 Arabidopsis thaliana clone U51311 putative MYB family transcription factor (At5g06100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010452523.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010452524.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLD7LZ380.0D7LZ38_ARALL; ATMYB33/MYB33
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33